alpha Actinin 4 antibody (70R-1171)

Rabbit polyclonal alpha Actinin 4 antibody raised against the N terminal of ACTN4

Synonyms Polyclonal alpha Actinin 4 antibody, Anti-alpha Actinin 4 antibody, FSGS1 antibody, DKFZp686K23158 antibody, ACTN4 antibody, FSGS antibody
Specificity Alpha Actinin 4 antibody was raised against the N terminal of ACTN4
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen alpha Actinin 4 antibody was raised using the N terminal of ACTN4 corresponding to a region with amino acids LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA
Assay Information Alpha Actinin 4 Blocking Peptide, catalog no. 33R-5045, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 4 antibody


Western Blot analysis using Alpha Actinin 4 antibody (70R-1171)

Alpha Actinin 4 antibody (70R-1171) used at 0.625 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 100 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ACTN4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.625 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Alpha actinins belong to the spectrin superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Alpha actinin is an actin-binding protein with multiple roles in different cell types.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Alpha Actinin 4 antibody (70R-1171) | Alpha Actinin 4 antibody (70R-1171) used at 0.625 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors