ALPPL2 antibody (70R-1575)

Rabbit polyclonal ALPPL2 antibody raised against the N terminal of ALPPL2

Synonyms Polyclonal ALPPL2 antibody, Anti-ALPPL2 antibody, GCAP antibody, ALPPL antibody, ALPG antibody, Alkaline Phosphatase Placental-Like 2 antibody
Specificity ALPPL2 antibody was raised against the N terminal of ALPPL2
Cross Reactivity Human
Applications WB
Immunogen ALPPL2 antibody was raised using the N terminal of ALPPL2 corresponding to a region with amino acids MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT
Assay Information ALPPL2 Blocking Peptide, catalog no. 33R-6329, is also available for use as a blocking control in assays to test for specificity of this ALPPL2 antibody


Western Blot analysis using ALPPL2 antibody (70R-1575)

ALPPL2 antibody (70R-1575) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ALPPL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The exact physiological function of the alkaline phosphatases is not known. ALPPL2 is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ALPPL2 antibody (70R-1575) | ALPPL2 antibody (70R-1575) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €260.31
Size: 100 ug
View Our Distributors