AMDHD1 antibody (70R-4162)

Rabbit polyclonal AMDHD1 antibody raised against the N terminal of AMDHD1

Synonyms Polyclonal AMDHD1 antibody, Anti-AMDHD1 antibody, Amidohydrolase Domain Containing 1 antibody, MGC35366 antibody, HMFT1272 antibody
Specificity AMDHD1 antibody was raised against the N terminal of AMDHD1
Cross Reactivity Human
Applications WB
Immunogen AMDHD1 antibody was raised using the N terminal of AMDHD1 corresponding to a region with amino acids AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV
Assay Information AMDHD1 Blocking Peptide, catalog no. 33R-1604, is also available for use as a blocking control in assays to test for specificity of this AMDHD1 antibody


Western Blot analysis using AMDHD1 antibody (70R-4162)

AMDHD1 antibody (70R-4162) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AMDHD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of AMDHD protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AMDHD1 antibody (70R-4162) | AMDHD1 antibody (70R-4162) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors