AMN1 Blocking Peptide (33R-7333)

A synthetic peptide for use as a blocking control in assays to test for specificity of AMN1 antibody, catalog no. 70R-4424

Synonyms AMN1 control peptide, AMN1 antibody Blocking Peptide, Anti-AMN1 Blocking Peptide, Antagonist Of Mitotic Exit Network 1 Homolog Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQIT
Molecular Weight 28 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AMN1 belongs to the AMN1 family. The exact function of AMN1 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors