AMN1 Blocking Peptide (33R-7333)
A synthetic peptide for use as a blocking control in assays to test for specificity of AMN1 antibody, catalog no. 70R-4424
Overview
Overview
| Synonyms | AMN1 control peptide, AMN1 antibody Blocking Peptide, Anti-AMN1 Blocking Peptide, Antagonist Of Mitotic Exit Network 1 Homolog Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQIT |
|---|---|
| Molecular Weight | 28 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | AMN1 belongs to the AMN1 family. The exact function of AMN1 remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product