AMY2B Blocking Peptide (33R-10354)

A synthetic peptide for use as a blocking control in assays to test for specificity of AMY2B antibody, catalog no. 70R-10396

Synonyms AMY2B control peptide, AMY2B antibody Blocking Peptide, Anti-AMY2B Blocking Peptide, amylase, alpha 2B, pancreatic Blocking Peptide, AMY2 Blocking Peptide, AMY2B, AMYB-2, AMYB 2, AMYB-2 Blocking Peptide, AMYB 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues KWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWD
Molecular Weight 56 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors