AMZ2 Blocking Peptide (33R-1072)
A synthetic peptide for use as a blocking control in assays to test for specificity of AMZ2 antibody, catalog no. 70R-9376
Overview
Overview
| Synonyms | AMZ2 control peptide, AMZ2 antibody Blocking Peptide, Anti-AMZ2 Blocking Peptide, archaelysin family metallopeptidase 2 Blocking Peptide, AMZ2, AMZ-2, AMZ 2, AMZ-2 Blocking Peptide, AMZ 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | ACLMQGSNHLEEADRRPLNLCPICLHKLQCAVGFSIVERYKALVRWIDDE |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | AMZ2 is a Zinc metalloprotease. Exhibits activity against angiotensin-3 in vitro. Does not hydrolyze either neurogranin or angiotensin-2. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product