ANAPC7 antibody (70R-5641)

Rabbit polyclonal ANAPC7 antibody raised against the C terminal of ANAPC7

Synonyms Polyclonal ANAPC7 antibody, Anti-ANAPC7 antibody, Anaphase Promoting Complex Subunit 7 antibody, APC7 antibody
Specificity ANAPC7 antibody was raised against the C terminal of ANAPC7
Cross Reactivity Human,Mouse,Dog
Applications IHC, WB
Immunogen ANAPC7 antibody was raised using the C terminal of ANAPC7 corresponding to a region with amino acids ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS
Assay Information ANAPC7 Blocking Peptide, catalog no. 33R-1371, is also available for use as a blocking control in assays to test for specificity of this ANAPC7 antibody


Immunohistochemical staining using ANAPC7 antibody (70R-5641)

ANAPC7 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANAPC7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ANAPC7 antibody (70R-5641) | ANAPC7 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using ANAPC7 antibody (70R-5641) | ANAPC7 antibody (70R-5641) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors