ANGPTL3 antibody (70R-4607)

Rabbit polyclonal ANGPTL3 antibody raised against the N terminal of ANGPTL3

Synonyms Polyclonal ANGPTL3 antibody, Anti-ANGPTL3 antibody, Angiopoietin-Like 3 antibody, ANGPT5 antibody
Specificity ANGPTL3 antibody was raised against the N terminal of ANGPTL3
Cross Reactivity Human,Mouse
Applications WB
Immunogen ANGPTL3 antibody was raised using the N terminal of ANGPTL3 corresponding to a region with amino acids IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL
Assay Information ANGPTL3 Blocking Peptide, catalog no. 33R-3960, is also available for use as a blocking control in assays to test for specificity of this ANGPTL3 antibody


Western Blot analysis using ANGPTL3 antibody (70R-4607)

ANGPTL3 antibody (70R-4607) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANGPTL3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ANGPTL3 antibody (70R-4607) | ANGPTL3 antibody (70R-4607) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors