ANKMY2 antibody (70R-3554)

Rabbit polyclonal ANKMY2 antibody raised against the N terminal of ANKMY2

Synonyms Polyclonal ANKMY2 antibody, Anti-ANKMY2 antibody, ZMYND20 antibody, Ankyrin Repeat And Mynd Domain Containing 2 antibody, DKFZP564O043 antibody
Specificity ANKMY2 antibody was raised against the N terminal of ANKMY2
Cross Reactivity Human
Applications WB
Immunogen ANKMY2 antibody was raised using the N terminal of ANKMY2 corresponding to a region with amino acids DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL
Assay Information ANKMY2 Blocking Peptide, catalog no. 33R-2226, is also available for use as a blocking control in assays to test for specificity of this ANKMY2 antibody


Western Blot analysis using ANKMY2 antibody (70R-3554)

ANKMY2 antibody (70R-3554) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANKMY2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ANKMY2 antibody (70R-3554) | ANKMY2 antibody (70R-3554) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors