ANKRD37 antibody (70R-3163)

Rabbit polyclonal ANKRD37 antibody raised against the middle region of ANKRD37

Synonyms Polyclonal ANKRD37 antibody, Anti-ANKRD37 antibody, Ankyrin Repeat Domain 37 antibody, Lrp2bp antibody, MGC111507 antibody
Specificity ANKRD37 antibody was raised against the middle region of ANKRD37
Cross Reactivity Human
Applications WB
Immunogen ANKRD37 antibody was raised using the middle region of ANKRD37 corresponding to a region with amino acids GFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRK
Assay Information ANKRD37 Blocking Peptide, catalog no. 33R-3262, is also available for use as a blocking control in assays to test for specificity of this ANKRD37 antibody

Images

Western Blot analysis using ANKRD37 antibody (70R-3163)

ANKRD37 antibody (70R-3163) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANKRD37 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ANKRD37 antibody (70R-3163) | ANKRD37 antibody (70R-3163) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors