ANKRD54 antibody (70R-4555)

Rabbit polyclonal ANKRD54 antibody raised against the middle region of ANKRD54

Synonyms Polyclonal ANKRD54 antibody, Anti-ANKRD54 antibody, Ankyrin Repeat Domain 54 antibody
Specificity ANKRD54 antibody was raised against the middle region of ANKRD54
Cross Reactivity Human
Applications WB
Immunogen ANKRD54 antibody was raised using the middle region of ANKRD54 corresponding to a region with amino acids EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGND
Assay Information ANKRD54 Blocking Peptide, catalog no. 33R-2788, is also available for use as a blocking control in assays to test for specificity of this ANKRD54 antibody


Western Blot analysis using ANKRD54 antibody (70R-4555)

ANKRD54 antibody (70R-4555) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANKRD54 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ANKRD54 is involved in protein complex binding and protein kinase regulator activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ANKRD54 antibody (70R-4555) | ANKRD54 antibody (70R-4555) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors