ANKS3 antibody (70R-3461)

Rabbit polyclonal ANKS3 antibody raised against the N terminal of ANKS3

Synonyms Polyclonal ANKS3 antibody, Anti-ANKS3 antibody, Ankyrin Repeat And Sterile Alpha Motif Domain Containing 3 antibody, FLJ32767 antibody, FLJ32345 antibody, KIAA1977 antibody
Specificity ANKS3 antibody was raised against the N terminal of ANKS3
Cross Reactivity Human,Mouse
Applications WB
Immunogen ANKS3 antibody was raised using the N terminal of ANKS3 corresponding to a region with amino acids WHGLGTQVSGEELDVPLDLHTAASIGQYEVVKECVQRRELDLNKKNGGGW
Assay Information ANKS3 Blocking Peptide, catalog no. 33R-9953, is also available for use as a blocking control in assays to test for specificity of this ANKS3 antibody

Images

Western Blot analysis using ANKS3 antibody (70R-3461)

ANKS3 antibody (70R-3461) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANKS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ANKS3 contains 1 SAM (sterile alpha motif) domain and 6 ANK repeats. The exact function of ANKS3 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ANKS3 antibody (70R-3461) | ANKS3 antibody (70R-3461) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors