Annexin A1 antibody (70R-1703)

Rabbit polyclonal Annexin A1 antibody raised against the N terminal of ANXA1

Synonyms Polyclonal Annexin A1 antibody, Anti-Annexin A1 antibody, Annexin A1, Annexin A 1, Annexin A-1, Annexin A 1 antibody, Annexin A-1 antibody, ANXA1 antibody
Specificity Annexin A1 antibody was raised against the N terminal of ANXA1
Cross Reactivity Human
Applications IHC, WB
Immunogen Annexin A1 antibody was raised using the N terminal of ANXA1 corresponding to a region with amino acids WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD
Assay Information Annexin A1 Blocking Peptide, catalog no. 33R-9944, is also available for use as a blocking control in assays to test for specificity of this Annexin A1 antibody


Western Blot analysis using Annexin A1 antibody (70R-1703)

Annexin A1 antibody (70R-1703) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ANXA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ANXA1 encodes a protein that belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Annexin A1 antibody (70R-1703) | Annexin A1 antibody (70R-1703) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors