Annexin A7 antibody (70R-1667)

Rabbit polyclonal Annexin A7 antibody raised against the N terminal of ANXA7

Synonyms Polyclonal Annexin A7 antibody, Anti-Annexin A7 antibody, ANXA7 antibody, Annexin A7, Annexin A-7 antibody, Annexin A-7, Annexin A 7 antibody, Annexin A 7
Specificity Annexin A7 antibody was raised against the N terminal of ANXA7
Cross Reactivity Human
Applications WB
Immunogen Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP
Assay Information Annexin A7 Blocking Peptide, catalog no. 33R-6528, is also available for use as a blocking control in assays to test for specificity of this Annexin A7 antibody


Western Blot analysis using Annexin A7 antibody (70R-1667)

Annexin A7 antibody (70R-1667) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ANXA7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ANXA7 is a member of the annexin family of calcium-dependent phospholipid binding proteins. The Annexin VII gene contains 14 exons and spans approximately 34 kb of DNA. An alternatively spliced cassette exon results in two mRNA transcripts of 2.0 and 2.4 kb which are predicted to generate two protein isoforms differing in their N-terminal domain. The alternative splicing event is tissue specific and the mRNA containing the cassette exon is prevalent in brain, heart and skeletal muscle.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Annexin A7 antibody (70R-1667) | Annexin A7 antibody (70R-1667) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors