Annexin A7 antibody (70R-1680)

Rabbit polyclonal Annexin A7 antibody raised against the N terminal of ANXA7

Synonyms Polyclonal Annexin A7 antibody, Anti-Annexin A7 antibody, Annexin A7, Annexin A-7 antibody, ANXA7 antibody, Annexin A-7, Annexin A 7 antibody, Annexin A 7
Specificity Annexin A7 antibody was raised against the N terminal of ANXA7
Cross Reactivity Human
Applications WB
Immunogen Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMK
Assay Information Annexin A7 Blocking Peptide, catalog no. 33R-3296, is also available for use as a blocking control in assays to test for specificity of this Annexin A7 antibody


Western Blot analysis using Annexin A7 antibody (70R-1680)

Annexin A7 antibody (70R-1680) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ANXA7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Annexin A7 is a member of the annexin family of calcium-dependent phospholipid binding proteins. The Annexin A7 gene contains 14 exons and spans approximately 34 kb of DNA. Structural analysis of the protein suggests that Annexin A7 is a membrane binding protein with diverse properties including voltage-sensitive calcium channel activity, ion selectivity and membrane fusion.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Annexin A7 antibody (70R-1680) | Annexin A7 antibody (70R-1680) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors