ANTP Blocking Peptide (33R-7700)

A synthetic peptide for use as a blocking control in assays to test for specificity of Antp antibody, catalog no. 70R-2190

Synonyms ANTP control peptide, ANTP antibody Blocking Peptide, Anti-ANTP Blocking Peptide, Dmel_CG1028 Blocking Peptide, 3.4 Blocking Peptide, ANT-C Blocking Peptide, ANT-P Blocking Peptide, Ant Blocking Peptide, AntP Blocking Peptide, AntP1 Blocking Peptide, CG1028 Blocking Peptide, DMANTPE1 Blocking Peptide, DRO15DC96Z Blocking Peptide, DmAntp Blocking Peptide, Hu Blocking Peptide, Scx Blocking Peptide, l(3)84Ba Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Antp is a sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. It provides cells with specific positional identities on the anterior-posterior axis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors