ANTP Blocking Peptide (33R-7700)
A synthetic peptide for use as a blocking control in assays to test for specificity of Antp antibody, catalog no. 70R-2190
Overview
Overview
| Synonyms | ANTP control peptide, ANTP antibody Blocking Peptide, Anti-ANTP Blocking Peptide, Dmel_CG1028 Blocking Peptide, 3.4 Blocking Peptide, ANT-C Blocking Peptide, ANT-P Blocking Peptide, Ant Blocking Peptide, AntP Blocking Peptide, AntP1 Blocking Peptide, CG1028 Blocking Peptide, DMANTPE1 Blocking Peptide, DRO15DC96Z Blocking Peptide, DmAntp Blocking Peptide, Hu Blocking Peptide, Scx Blocking Peptide, l(3)84Ba Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Antp is a sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. It provides cells with specific positional identities on the anterior-posterior axis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product