ANTXR1 Blocking Peptide (33R-9794)
A synthetic peptide for use as a blocking control in assays to test for specificity of ANTXR1 antibody, catalog no. 70R-7338
Overview
Overview
| Synonyms | ANTXR1 control peptide, ANTXR1 antibody Blocking Peptide, Anti-ANTXR1 Blocking Peptide, Anthrax Toxin Receptor 1 Blocking Peptide, ATR Blocking Peptide, FLJ10601 Blocking Peptide, FLJ11298 Blocking Peptide, FLJ21776 Blocking Peptide, TEM8 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK |
|---|---|
| Molecular Weight | 60 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ANTXR1 is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. ANTXR1 has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product