ANTXR1 Blocking Peptide (33R-9794)

A synthetic peptide for use as a blocking control in assays to test for specificity of ANTXR1 antibody, catalog no. 70R-7338

Synonyms ANTXR1 control peptide, ANTXR1 antibody Blocking Peptide, Anti-ANTXR1 Blocking Peptide, Anthrax Toxin Receptor 1 Blocking Peptide, ATR Blocking Peptide, FLJ10601 Blocking Peptide, FLJ11298 Blocking Peptide, FLJ21776 Blocking Peptide, TEM8 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK
Molecular Weight 60 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ANTXR1 is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. ANTXR1 has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors