Ap3b1 Blocking Peptide (33R-6503)
A synthetic peptide for use as a blocking control in assays to test for specificity of Ap3b1 antibody, catalog no. 70R-8002
Overview
Overview
| Synonyms | Ap3b1 control peptide, Ap3b1 antibody Blocking Peptide, Anti-Ap3b1 Blocking Peptide, adaptor-related protein complex 3, beta 1 subunit Blocking Peptide, Ap3b1 Blocking Peptide, Ap3b1, Apb1-3, Apb1 3, Apb1-3 Blocking Peptide, Apb1 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM |
|---|---|
| Molecular Weight | 121 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of Ap3b1 remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product