Ap3b1 Blocking Peptide (33R-6503)

A synthetic peptide for use as a blocking control in assays to test for specificity of Ap3b1 antibody, catalog no. 70R-8002

Synonyms Ap3b1 control peptide, Ap3b1 antibody Blocking Peptide, Anti-Ap3b1 Blocking Peptide, adaptor-related protein complex 3, beta 1 subunit Blocking Peptide, Ap3b1 Blocking Peptide, Ap3b1, Apb1-3, Apb1 3, Apb1-3 Blocking Peptide, Apb1 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM
Molecular Weight 121 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Ap3b1 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors