APBB1IP antibody (70R-4095)

Rabbit polyclonal APBB1IP antibody raised against the N terminal Of Apbb1Ip

Synonyms Polyclonal APBB1IP antibody, Anti-APBB1IP antibody, INAG1 antibody, PREL1 antibody, RARP1 antibody, RIAM antibody
Specificity APBB1IP antibody was raised against the N terminal Of Apbb1Ip
Cross Reactivity Human
Applications WB
Immunogen APBB1IP antibody was raised using the N terminal Of Apbb1Ip corresponding to a region with amino acids LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG
Assay Information APBB1IP Blocking Peptide, catalog no. 33R-5496, is also available for use as a blocking control in assays to test for specificity of this APBB1IP antibody


Western Blot analysis using APBB1IP antibody (70R-4095)

APBB1IP antibody (70R-4095) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APBB1IP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance APBB1IP appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling. APBB1IP suppresses insulin-induced promoter activities through AP1 and SRE. APBB1IP mediates Rap1-induced adhesion.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using APBB1IP antibody (70R-4095) | APBB1IP antibody (70R-4095) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors