APBB2 Blocking Peptide (33R-7664)
A synthetic peptide for use as a blocking control in assays to test for specificity of APBB2 antibody, catalog no. 70R-5679
Overview
Overview
| Synonyms | APBB2 control peptide, APBB2 antibody Blocking Peptide, Anti-APBB2 Blocking Peptide, Amyloid Beta A4 Precursor Protein-Binding 2B Blocking Peptide, FE65L Blocking Peptide, FE65L1 Blocking Peptide, MGC35575 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS |
|---|---|
| Molecular Weight | 81 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | APBB2 may modulate the internalization of beta-amyloid precursor protein. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product