APBB3 Blocking Peptide (33R-8950)
A synthetic peptide for use as a blocking control in assays to test for specificity of APBB3 antibody, catalog no. 70R-4577
Overview
Overview
| Synonyms | APBB3 control peptide, APBB3 antibody Blocking Peptide, Anti-APBB3 Blocking Peptide, Amyloid Beta A4 Precursor Protein-Binding 3B Blocking Peptide, FE65L2 Blocking Peptide, MGC150555 Blocking Peptide, MGC87674 Blocking Peptide, SRA Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR |
|---|---|
| Molecular Weight | 52 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product