APBB3 Blocking Peptide (33R-8950)

A synthetic peptide for use as a blocking control in assays to test for specificity of APBB3 antibody, catalog no. 70R-4577

Synonyms APBB3 control peptide, APBB3 antibody Blocking Peptide, Anti-APBB3 Blocking Peptide, Amyloid Beta A4 Precursor Protein-Binding 3B Blocking Peptide, FE65L2 Blocking Peptide, MGC150555 Blocking Peptide, MGC87674 Blocking Peptide, SRA Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR
Molecular Weight 52 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors