APEH antibody (70R-2583)

Rabbit polyclonal APEH antibody raised against the N terminal of APEH

Synonyms Polyclonal APEH antibody, Anti-APEH antibody, OPH antibody, MGC2178 antibody, DNF15S2 antibody, APH antibody, ACPH antibody, N-Acylaminoacyl-Peptide Hydrolase antibody, D3S48E antibody, D3F15S2 antibody
Specificity APEH antibody was raised against the N terminal of APEH
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen APEH antibody was raised using the N terminal of APEH corresponding to a region with amino acids VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR
Assay Information APEH Blocking Peptide, catalog no. 33R-9916, is also available for use as a blocking control in assays to test for specificity of this APEH antibody

Images

Western blot analysis using APEH antibody (70R-2583)

Recommended APEH Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APEH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance APEH is the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using APEH antibody (70R-2583) | Recommended APEH Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using APEH antibody (70R-2583) | Tissue analyzed: Human Fetal Liver; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors