ApoBEC2 antibody (70R-1425)

Rabbit polyclonal ApoBEC2 antibody raised against the N terminal of APOBEC2

Synonyms Polyclonal ApoBEC2 antibody, Anti-ApoBEC2 antibody, Apolipoprotein B mRNA Editing Enzyme Catalytic Polypeptide-Like 2 antibody
Specificity ApoBEC2 antibody was raised against the N terminal of APOBEC2
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen ApoBEC2 antibody was raised using the N terminal of APOBEC2 corresponding to a region with amino acids VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN
Assay Information ApoBEC2 Blocking Peptide, catalog no. 33R-9438, is also available for use as a blocking control in assays to test for specificity of this ApoBEC2 antibody


Western Blot analysis using ApoBEC2 antibody (70R-1425)

ApoBEC2 antibody (70R-1425) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of APOBEC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ApoBEC2 antibody (70R-1425) | ApoBEC2 antibody (70R-1425) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors