ApoBEC4 antibody (70R-3301)

Rabbit polyclonal ApoBEC4 antibody

Synonyms Polyclonal ApoBEC4 antibody, Anti-ApoBEC4 antibody, MGC26594 antibody, Apolipoprotein B mRNA Editing Enzyme Catalytic Polypeptide-Like 4 antibody, C1orf169 antibody
Cross Reactivity Human
Applications WB
Immunogen ApoBEC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VRHLNMPQMSFQETKDLGRLPTGRSVEIVEITEQFASSKEADEKKKKKGK
Assay Information ApoBEC4 Blocking Peptide, catalog no. 33R-9775, is also available for use as a blocking control in assays to test for specificity of this ApoBEC4 antibody


Western Blot analysis using ApoBEC4 antibody (70R-3301)

ApoBEC4 antibody (70R-3301) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOBEC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ApoBEC4 antibody (70R-3301) | ApoBEC4 antibody (70R-3301) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors