APPBP2 antibody (70R-2199)

Rabbit polyclonal APPBP2 antibody

Synonyms Polyclonal APPBP2 antibody, Anti-APPBP2 antibody, PAT1 antibody, Amyloid Beta Precursor Protein Binding Protein 2 antibody, KIAA0228 antibody, HS.84084 antibody, Cytoplasmic Tail Binding Protein 2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen APPBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLN
Assay Information APPBP2 Blocking Peptide, catalog no. 33R-7479, is also available for use as a blocking control in assays to test for specificity of this APPBP2 antibody


Western Blot analysis using APPBP2 antibody (70R-2199)

APPBP2 antibody (70R-2199) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APPBP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance APPBP2 interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. APPBP2 has been found to be highly expressed in breast cancer.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using APPBP2 antibody (70R-2199) | APPBP2 antibody (70R-2199) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors