APPD Blocking Peptide (33R-7671)
A synthetic peptide for use as a blocking control in assays to test for specificity of APPD antibody, catalog no. 20R-1320
Overview
Overview
| Synonyms | APPD control peptide, APPD antibody Blocking Peptide, Anti-APPD Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS |
|---|---|
| Molecular Weight | 31 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | APPD (Apoptosis-inducing protein D; phafin 1) is predicted through gene annotation and contains pleckstrin homology domain. It may binds to two Zn++ ions through its FYVE zinc finger domain. Biological function of this protein has not been clearly mapped yet. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product