APRT antibody (70R-3109)

Rabbit polyclonal APRT antibody raised against the N terminal of APRT

Synonyms Polyclonal APRT antibody, Anti-APRT antibody, MGC129961 antibody, MGC125857 antibody, Adenine Phosphoribosyltransferase antibody, DKFZp686D13177 antibody, MGC125856 antibody, AMP antibody
Specificity APRT antibody was raised against the N terminal of APRT
Cross Reactivity Human
Applications WB
Immunogen APRT antibody was raised using the N terminal of APRT corresponding to a region with amino acids ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK
Assay Information APRT Blocking Peptide, catalog no. 33R-1105, is also available for use as a blocking control in assays to test for specificity of this APRT antibody


Western Blot analysis using APRT antibody (70R-3109)

APRT antibody (70R-3109) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APRT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Adenine phosphoribosyltransferase (APRT) belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using APRT antibody (70R-3109) | APRT antibody (70R-3109) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors