ARAF Blocking Peptide (33R-7324)

A synthetic peptide for use as a blocking control in assays to test for specificity of ARAF antibody, catalog no. 70R-5718

Synonyms ARAF control peptide, ARAF antibody Blocking Peptide, Anti-ARAF Blocking Peptide, V-Raf Murine Sarcoma 3611 Viral Oncogene Homolog Blocking Peptide, A-RAF Blocking Peptide, ARAF1 Blocking Peptide, PKS2 Blocking Peptide, RAFA1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW
Molecular Weight 67 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARAF belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, RAF subfamily. It contains 1 phorbol-ester/DAG-type zinc finger, 1 protein kinase domain, and 1 RBD (Ras-binding) domain. ARAF is involved in the transduction of mitogenic signals from the cell membrane to the nucleus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors