ARAF Blocking Peptide (33R-7324)
A synthetic peptide for use as a blocking control in assays to test for specificity of ARAF antibody, catalog no. 70R-5718
Overview
Overview
| Synonyms | ARAF control peptide, ARAF antibody Blocking Peptide, Anti-ARAF Blocking Peptide, V-Raf Murine Sarcoma 3611 Viral Oncogene Homolog Blocking Peptide, A-RAF Blocking Peptide, ARAF1 Blocking Peptide, PKS2 Blocking Peptide, RAFA1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW |
|---|---|
| Molecular Weight | 67 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ARAF belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, RAF subfamily. It contains 1 phorbol-ester/DAG-type zinc finger, 1 protein kinase domain, and 1 RBD (Ras-binding) domain. ARAF is involved in the transduction of mitogenic signals from the cell membrane to the nucleus. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product