Arginase 1 antibody (70R-1084)

Rabbit polyclonal Arginase 1 antibody raised against the N terminal of ARG1

Synonyms Polyclonal Arginase 1 antibody, Anti-Arginase 1 antibody, ARG antibody, Arginase1 antibody, A I antibody, ARG 1 antibody, Arginase liver antibody, Al antibody, Type I arginase antibody, Arginase type I antibody, Liver type arginase antibody, Liver Arginase antibody, ARG1 antibody, Arginase 1 antibody
Specificity Arginase 1 antibody was raised against the N terminal of ARG1
Cross Reactivity Human,Rat,Dog
Applications IHC, WB
Immunogen Arginase 1 antibody was raised using the N terminal of ARG1 corresponding to a region with amino acids HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK
Assay Information Arginase 1 Blocking Peptide, catalog no. 33R-3855, is also available for use as a blocking control in assays to test for specificity of this Arginase 1 antibody


Immunohistochemical staining using Arginase 1 antibody (70R-1084)

Arginase 1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ARG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Arginase catalyzes the hydrolysis of arginine to ornithine and urea. The type I isoform of ARG1, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using Arginase 1 antibody (70R-1084) | Arginase 1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using Arginase 1 antibody (70R-1084) | Arginase 1 antibody (70R-1084) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using Arginase 1 antibody (70R-1084) | Arginase 1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X

Availability: In stock

Price: €296.37
Size: 100 ug
View Our Distributors