Arginase 2 antibody (70R-2322)

Rabbit polyclonal Arginase 2 antibody raised against the C terminal of ARG2

Synonyms Polyclonal Arginase 2 antibody, Anti-Arginase 2 antibody, Type II arginase antibody, Arginase Type Ii antibody, Arginase 2 antibody, ARG 2 antibody, Arginase liver antibody, Arginase2 antibody, ARG2 antibody, AIl antibody, Liver type arginase antibody, A II antibody, Arginase type II antibody
Specificity Arginase 2 antibody was raised against the C terminal of ARG2
Cross Reactivity Human,Mouse
Applications WB
Immunogen Arginase 2 antibody was raised using the C terminal of ARG2 corresponding to a region with amino acids SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT
Assay Information Arginase 2 Blocking Peptide, catalog no. 33R-8306, is also available for use as a blocking control in assays to test for specificity of this Arginase 2 antibody


Western Blot analysis using Arginase 2 antibody (70R-2322)

Arginase 2 antibody (70R-2322) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARG2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. ARG2 (type II isoform) is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Arginase 2 antibody (70R-2322) | Arginase 2 antibody (70R-2322) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors