ARHGEF19 Blocking Peptide (33R-7904)

A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGEF19 antibody, catalog no. 70R-4538

Synonyms ARHGEF19 control peptide, ARHGEF19 antibody Blocking Peptide, Anti-ARHGEF19 Blocking Peptide, Rho RNA guanine Nucleotide Exchange Factor Blocking Peptide, Gef 19 Blocking Peptide, FLJ33962 Blocking Peptide, RP4-733M16.1 Blocking Peptide, WGEF Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS
Molecular Weight 89 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Guanine nucleotide exchange factors (GEFs) such as ARHGEF19 accelerate the GTPase activity of Rho GTPases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors