ARHGEF19 Blocking Peptide (33R-7904)
A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGEF19 antibody, catalog no. 70R-4538
Overview
Overview
| Synonyms | ARHGEF19 control peptide, ARHGEF19 antibody Blocking Peptide, Anti-ARHGEF19 Blocking Peptide, Rho RNA guanine Nucleotide Exchange Factor Blocking Peptide, Gef 19 Blocking Peptide, FLJ33962 Blocking Peptide, RP4-733M16.1 Blocking Peptide, WGEF Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS |
|---|---|
| Molecular Weight | 89 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Guanine nucleotide exchange factors (GEFs) such as ARHGEF19 accelerate the GTPase activity of Rho GTPases. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product