ARL13B antibody (70R-4152)

Rabbit polyclonal ARL13B antibody raised against the middle region of ARL13B

Synonyms Polyclonal ARL13B antibody, Anti-ARL13B antibody, ARL2L1 antibody, DKFZp761H079 antibody, DKFZp686E2075 antibody, Adp-Ribosylation Factor-Like 13B antibody, MGC120611 antibody, DKFZp686M2074 antibody, MGC120612 antibody, DKFZp686L2472 antibody
Specificity ARL13B antibody was raised against the middle region of ARL13B
Cross Reactivity Human
Applications WB
Immunogen ARL13B antibody was raised using the middle region of ARL13B corresponding to a region with amino acids VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK
Assay Information ARL13B Blocking Peptide, catalog no. 33R-9507, is also available for use as a blocking control in assays to test for specificity of this ARL13B antibody


Western Blot analysis using ARL13B antibody (70R-4152)

ARL13B antibody (70R-4152) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARL13B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ARL13B antibody (70R-4152) | ARL13B antibody (70R-4152) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors