ARMCX6 antibody (70R-1805)

Rabbit polyclonal ARMCX6 antibody raised against the N terminal of ARMCX6

Synonyms Polyclonal ARMCX6 antibody, Anti-ARMCX6 antibody, FLJ20811 antibody, Armadillo Repeat Containing X-Linked 6 antibody
Specificity ARMCX6 antibody was raised against the N terminal of ARMCX6
Cross Reactivity Human,Mouse
Applications IHC, WB
Immunogen ARMCX6 antibody was raised using the N terminal of ARMCX6 corresponding to a region with amino acids TMARPWTEDGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTW
Assay Information ARMCX6 Blocking Peptide, catalog no. 33R-9198, is also available for use as a blocking control in assays to test for specificity of this ARMCX6 antibody


Immunohistochemical staining using ARMCX6 antibody (70R-1805)

ARMCX6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ARMCX6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ARMC protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ARMCX6 antibody (70R-1805) | ARMCX6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using ARMCX6 antibody (70R-1805) | ARMCX6 antibody (70R-1805) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors