ART4 antibody (70R-5487)

Rabbit polyclonal ART4 antibody

Synonyms Polyclonal ART4 antibody, Anti-ART4 antibody, ART-4, Adp-Ribosyltransferase 4 antibody, ART4, ART 4, CD297 antibody, ART-4 antibody, DO antibody, ART 4 antibody, DOK1 antibody, Dombrock Blood Group antibody
Cross Reactivity Human
Applications WB
Immunogen ART4 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTLFTIF
Assay Information ART4 Blocking Peptide, catalog no. 33R-9161, is also available for use as a blocking control in assays to test for specificity of this ART4 antibody


Western Blot analysis using ART4 antibody (70R-5487)

ART4 antibody (70R-5487) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ART4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ART4 is a protein that contains a mono-ADP-ribosylation (ART) motif. It is a member of the ADP-ribosyltransferase gene family but enzymatic activity has not been demonstrated experimentally. Antigens of the Dombrock blood group system are located on the gene product, which is glycosylphosphatidylinosotol-anchored to the erythrocyte membrane. Allelic variants, some of which lead to adverse transfusion reactions, are known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ART4 antibody (70R-5487) | ART4 antibody (70R-5487) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors