ASB8 Blocking Peptide (33R-6512)
A synthetic peptide for use as a blocking control in assays to test for specificity of ASB8 antibody, catalog no. 70R-5837
Overview
Overview
| Synonyms | ASB8 control peptide, ASB8 antibody Blocking Peptide, Anti-ASB8 Blocking Peptide, Ankyrin Repeat And Socs Box-Containing 8 Blocking Peptide, FLJ21255 Blocking Peptide, MGC5540 Blocking Peptide, PP14212 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCT |
|---|---|
| Molecular Weight | 32 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ASB8 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product