ASB8 Blocking Peptide (33R-6512)

A synthetic peptide for use as a blocking control in assays to test for specificity of ASB8 antibody, catalog no. 70R-5837

Synonyms ASB8 control peptide, ASB8 antibody Blocking Peptide, Anti-ASB8 Blocking Peptide, Ankyrin Repeat And Socs Box-Containing 8 Blocking Peptide, FLJ21255 Blocking Peptide, MGC5540 Blocking Peptide, PP14212 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCT
Molecular Weight 32 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASB8 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors