ASPA antibody (70R-3333)

Rabbit polyclonal ASPA antibody

Synonyms Polyclonal ASPA antibody, Anti-ASPA antibody, ASP antibody, Canavan Disease antibody, Aspartoacylase antibody, ACY2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ASPA antibody was raised using a synthetic peptide corresponding to a region with amino acids RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS
Assay Information ASPA Blocking Peptide, catalog no. 33R-7964, is also available for use as a blocking control in assays to test for specificity of this ASPA antibody


Western Blot analysis using ASPA antibody (70R-3333)

ASPA antibody (70R-3333) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASPA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of SASP is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ASPA antibody (70R-3333) | ASPA antibody (70R-3333) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors