ASPH antibody (70R-1844)

Rabbit polyclonal ASPH antibody raised against the N terminal of ASPH

Synonyms Polyclonal ASPH antibody, Anti-ASPH antibody, HAAH antibody, BAH antibody, JCTN antibody, Aspartate Beta-Hydroxylase antibody, CASQ2BP1 antibody, junctin antibody
Specificity ASPH antibody was raised against the N terminal of ASPH
Cross Reactivity Human
Applications IHC, WB
Immunogen ASPH antibody was raised using the N terminal of ASPH corresponding to a region with amino acids SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE
Assay Information ASPH Blocking Peptide, catalog no. 33R-8411, is also available for use as a blocking control in assays to test for specificity of this ASPH antibody

Images

Western blot analysis using ASPH antibody (70R-1844)

Recommended ASPH Antibody Titration: 2.5ug/ml

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ASPH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using ASPH antibody (70R-1844) | Recommended ASPH Antibody Titration: 2.5ug/ml
  • Immunohistochemical staining using ASPH antibody (70R-1844) | Human Kidney

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors