ASZ1 antibody (70R-4579)

Rabbit polyclonal ASZ1 antibody raised against the middle region of ASZ1

Synonyms Polyclonal ASZ1 antibody, Anti-ASZ1 antibody, C7orf7 antibody, ANKL1 antibody, Ankyrin Repeat Sam And Basic Leucine Zipper Domain Containing 1 antibody, ALP1 antibody, MGC26634 antibody, GASZ antibody, Orf3 antibody
Specificity ASZ1 antibody was raised against the middle region of ASZ1
Cross Reactivity Human
Applications WB
Immunogen ASZ1 antibody was raised using the middle region of ASZ1 corresponding to a region with amino acids GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR
Assay Information ASZ1 Blocking Peptide, catalog no. 33R-3373, is also available for use as a blocking control in assays to test for specificity of this ASZ1 antibody


Western Blot analysis using ASZ1 antibody (70R-4579)

ASZ1 antibody (70R-4579) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASZ1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASZ1 plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ASZ1 antibody (70R-4579) | ASZ1 antibody (70R-4579) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors