ATE1 antibody (70R-2256)

Rabbit polyclonal ATE1 antibody raised against the N terminal of ATE1

Synonyms Polyclonal ATE1 antibody, Anti-ATE1 antibody, Arginyltransferase 1 antibody, MGC26724 antibody
Specificity ATE1 antibody was raised against the N terminal of ATE1
Cross Reactivity Human
Applications WB
Immunogen ATE1 antibody was raised using the N terminal of ATE1 corresponding to a region with amino acids CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM
Assay Information ATE1 Blocking Peptide, catalog no. 33R-1654, is also available for use as a blocking control in assays to test for specificity of this ATE1 antibody


Western Blot analysis using ATE1 antibody (70R-2256)

ATE1 antibody (70R-2256) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATE1 is an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in two transcript variants encoding distinct isoforms.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ATE1 antibody (70R-2256) | ATE1 antibody (70R-2256) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors