ATP1B4 Blocking Peptide (33R-1078)

A synthetic peptide for use as a blocking control in assays to test for specificity of ATP1B4 antibody, catalog no. 70R-6783

Synonyms ATP1B4 control peptide, ATP1B4 antibody Blocking Peptide, Anti-ATP1B4 Blocking Peptide, Atpase Blocking Peptide, Na+/K+ transporting, beta 4 polypeptide Blocking Peptide, Na+/K+ Transporting Beta 4 Polypeptide Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS
Molecular Weight 41 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene has been found in all vertebrate genomes sequenced to date. However, this gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species, this gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals, the encoded protein interacts with the nuclear transcriptional coregulator SKIP and may be involved in the regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors