ATP1B4 Blocking Peptide (33R-1078)
A synthetic peptide for use as a blocking control in assays to test for specificity of ATP1B4 antibody, catalog no. 70R-6783
Overview
Overview
| Synonyms | ATP1B4 control peptide, ATP1B4 antibody Blocking Peptide, Anti-ATP1B4 Blocking Peptide, Atpase Blocking Peptide, Na+/K+ transporting, beta 4 polypeptide Blocking Peptide, Na+/K+ Transporting Beta 4 Polypeptide Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS |
|---|---|
| Molecular Weight | 41 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene has been found in all vertebrate genomes sequenced to date. However, this gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species, this gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals, the encoded protein interacts with the nuclear transcriptional coregulator SKIP and may be involved in the regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found for this gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product