ATP6V1B2 antibody (70R-2506)

Rabbit polyclonal ATP6V1B2 antibody raised against the N terminal of ATP6V1B2

Synonyms Polyclonal ATP6V1B2 antibody, Anti-ATP6V1B2 antibody, Atpase H+ Transporting Lysosomal 56/58Kda V1 Subunit B2 antibody, VPP3 antibody, HO57 antibody, Vma2 antibody, ATP6B1B2 antibody, ATP6B2 antibody, VATB antibody
Specificity ATP6V1B2 antibody was raised against the N terminal of ATP6V1B2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ATP6V1B2 antibody was raised using the N terminal of ATP6V1B2 corresponding to a region with amino acids VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG
Assay Information ATP6V1B2 Blocking Peptide, catalog no. 33R-9821, is also available for use as a blocking control in assays to test for specificity of this ATP6V1B2 antibody

Images

Western Blot analysis using ATP6V1B2 antibody (70R-2506)

ATP6V1B2 antibody (70R-2506) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP6V1B2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATP6V1B2 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. ATP6V1B2 is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATP6V1B2 antibody (70R-2506) | ATP6V1B2 antibody (70R-2506) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors