ATP6V1E2 antibody (70R-2360)

Rabbit polyclonal ATP6V1E2 antibody raised against the middle region of ATP6V1E2

Synonyms Polyclonal ATP6V1E2 antibody, Anti-ATP6V1E2 antibody, MGC9341 antibody, Atpase H+ Transporting Lysosomal 31Kda V1 Subunit E2 antibody, ATP6V1EL2 antibody, VMA4 antibody, ATP6E1 antibody, ATP6EL2 antibody
Specificity ATP6V1E2 antibody was raised against the middle region of ATP6V1E2
Cross Reactivity Human
Applications WB
Immunogen ATP6V1E2 antibody was raised using the middle region of ATP6V1E2 corresponding to a region with amino acids LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV
Assay Information ATP6V1E2 Blocking Peptide, catalog no. 33R-5212, is also available for use as a blocking control in assays to test for specificity of this ATP6V1E2 antibody

Images

Western Blot analysis using ATP6V1E2 antibody (70R-2360)

ATP6V1E2 antibody (70R-2360) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP6V1E2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATP6V1E2 is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATP6V1E2 antibody (70R-2360) | ATP6V1E2 antibody (70R-2360) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors