ATPAF1 antibody (70R-4465)

Rabbit polyclonal ATPAF1 antibody raised against the N terminal of ATPAF1

Synonyms Polyclonal ATPAF1 antibody, Anti-ATPAF1 antibody, ATP11p antibody, MGC88060 antibody, ATP11 antibody, FLJ22351 antibody, Atp Synthase Mitochondrial F1 Complex Assembly Factor 1 antibody
Specificity ATPAF1 antibody was raised against the N terminal of ATPAF1
Cross Reactivity Human
Applications WB
Immunogen ATPAF1 antibody was raised using the N terminal of ATPAF1 corresponding to a region with amino acids GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI
Assay Information ATPAF1 Blocking Peptide, catalog no. 33R-3393, is also available for use as a blocking control in assays to test for specificity of this ATPAF1 antibody

Images

Western Blot analysis using ATPAF1 antibody (70R-4465)

ATPAF1 antibody (70R-4465) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATPAF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATPAF1 antibody (70R-4465) | ATPAF1 antibody (70R-4465) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors