ATXN10 Blocking Peptide (33R-10373)

A synthetic peptide for use as a blocking control in assays to test for specificity of ATXN10 antibody, catalog no. 70R-10385

Synonyms ATXN10 control peptide, ATXN10 antibody Blocking Peptide, Anti-ATXN10 Blocking Peptide, ataxin 10 Blocking Peptide, E46L Blocking Peptide, FLJ37990 Blocking Peptide, HUMEEP Blocking Peptide, SCA10 Blocking Peptide, ATXN10, ATXN-10, ATXN 10, ATXN-10 Blocking Peptide, ATXN 10 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PARLSGVMVPAPIQDLEALRALTALFKEQRNRETAPRTIFQRVLDILKKS
Molecular Weight 52 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein that may function in neuron survival, neuron differentiation, and neuritogenesis. These roles may be carried out via activation of the mitogen-activated protein kinase cascade. Expansion of a pentanucleotide repeat in an intronic region of this locus has been associated with spinocerebellar ataxia, type 10. Alternatively spliced transcript variants have been described.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors