ATXN7L1 antibody (70R-3220)

Rabbit polyclonal Ataxin 7-Like 1 antibody raised against the middle region of ATXN7L1

Synonyms Polyclonal ATXN7L1 antibody, Anti-ATXN7L1 antibody, Ataxin 7-Like 1 antibody, MGC33190 antibody, ATXN7L4 antibody, KIAA1218 antibody, FLJ40255 antibody, MGC10760 antibody
Specificity ATXN7L1 antibody was raised against the middle region of ATXN7L1
Cross Reactivity Human,Mouse
Applications WB
Immunogen ATXN7L1 antibody was raised using the middle region of ATXN7L1 corresponding to a region with amino acids KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED
Assay Information ATXN7L1 Blocking Peptide, catalog no. 33R-4717, is also available for use as a blocking control in assays to test for specificity of this ATXN7L1 antibody


Western Blot analysis using ATXN7L1 antibody (70R-3220)

ATXN7L1 antibody (70R-3220) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATXN7L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ATXN7L1 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ATXN7L1 antibody (70R-3220) | ATXN7L1 antibody (70R-3220) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors