AURKC antibody (70R-2679)

Rabbit polyclonal AURKC antibody raised against the middle region of AURKC

Synonyms Polyclonal AURKC antibody, Anti-AURKC antibody, aurora-C antibody, Aurora Kinase C antibody, AurC antibody, STK13 antibody, AIE2 antibody, AIK3 antibody
Specificity AURKC antibody was raised against the middle region of AURKC
Cross Reactivity Human
Applications WB
Immunogen AURKC antibody was raised using the middle region of AURKC corresponding to a region with amino acids TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL
Assay Information AURKC Blocking Peptide, catalog no. 33R-9386, is also available for use as a blocking control in assays to test for specificity of this AURKC antibody

Images

Western Blot analysis using AURKC antibody (70R-2679)

AURKC antibody (70R-2679) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AURKC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AURKC may play a part in organizing microtubules in relation to the function of the centrosome/spindle pole during mitosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AURKC antibody (70R-2679) | AURKC antibody (70R-2679) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors