BACE2 Blocking Peptide (33R-8612)

A synthetic peptide for use as a blocking control in assays to test for specificity of BACE2 antibody, catalog no. 70R-6559

Synonyms BACE2 control peptide, BACE2 antibody Blocking Peptide, Anti-BACE2 Blocking Peptide, Beta-Site App-Cleaving Enzyme 2 Blocking Peptide, AEPLC Blocking Peptide, ALP56 Blocking Peptide, ASP1 Blocking Peptide, ASP21 Blocking Peptide, BAE2 Blocking Peptide, CDA13 Blocking Peptide, CEAP1 Blocking Peptide, DRAP Blocking Peptide, BACE2, BACE-2, BACE 2, BACE-2 Blocking Peptide, BACE 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF
Molecular Weight 37 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors