BACE2 Blocking Peptide (33R-8612)
A synthetic peptide for use as a blocking control in assays to test for specificity of BACE2 antibody, catalog no. 70R-6559
Overview
Overview
| Synonyms | BACE2 control peptide, BACE2 antibody Blocking Peptide, Anti-BACE2 Blocking Peptide, Beta-Site App-Cleaving Enzyme 2 Blocking Peptide, AEPLC Blocking Peptide, ALP56 Blocking Peptide, ASP1 Blocking Peptide, ASP21 Blocking Peptide, BAE2 Blocking Peptide, CDA13 Blocking Peptide, CEAP1 Blocking Peptide, DRAP Blocking Peptide, BACE2, BACE-2, BACE 2, BACE-2 Blocking Peptide, BACE 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF |
|---|---|
| Molecular Weight | 37 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product