BAG3 Blocking Peptide (33R-6927)
A synthetic peptide for use as a blocking control in assays to test for specificity of BAG3 antibody, catalog no. 70R-6022
Overview
Overview
| Synonyms | BAG3 control peptide, BAG3 antibody Blocking Peptide, Anti-BAG3 Blocking Peptide, Bcl2-Associated Athanogene 3 Blocking Peptide, BAG-3 Blocking Peptide, BIS Blocking Peptide, CAIR-1 Blocking Peptide, MGC104307 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS |
|---|---|
| Molecular Weight | 61 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | BAG3 inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release. BAG3 has anti-apoptotic activity. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product