BAG3 Blocking Peptide (33R-6927)

A synthetic peptide for use as a blocking control in assays to test for specificity of BAG3 antibody, catalog no. 70R-6022

Synonyms BAG3 control peptide, BAG3 antibody Blocking Peptide, Anti-BAG3 Blocking Peptide, Bcl2-Associated Athanogene 3 Blocking Peptide, BAG-3 Blocking Peptide, BIS Blocking Peptide, CAIR-1 Blocking Peptide, MGC104307 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS
Molecular Weight 61 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BAG3 inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release. BAG3 has anti-apoptotic activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors