BAG5 Blocking Peptide (33R-10362)

A synthetic peptide for use as a blocking control in assays to test for specificity of BAG5 antibody, catalog no. 70R-10408

Synonyms BAG5 control peptide, BAG5 antibody Blocking Peptide, Anti-BAG5 Blocking Peptide, BCL2-associated athanogene 5 Blocking Peptide, BAG-5 Blocking Peptide, BAG5, BAG-5, BAG 5, BAG-5 Blocking Peptide, BAG 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LSDDKNYKKLERILTKQLFEIDSVDTEGKGDIQQARKRAAQETERLLKEL
Molecular Weight 56 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. Three transcript variants encoding two different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors