BBS4 Blocking Peptide (33R-10282)
A synthetic peptide for use as a blocking control in assays to test for specificity of BBS4 antibody, catalog no. 70R-4575
Overview
Overview
| Synonyms | BBS4 control peptide, BBS4 antibody Blocking Peptide, Anti-BBS4 Blocking Peptide, Bardet-Biedl Syndrome 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | YVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAA |
|---|---|
| Molecular Weight | 58 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, renal malformation and mental retardation. The proteins encoded by BBS gene family members are structurally diverse. The similar phenotypes exhibited by mutations in BBS gene family members are likely due to the protein's shared roles in cilia formation and function. Many BBS proteins localize to the basal bodies, ciliary axonemes, and pericentriolar regions of cells. BBS proteins may also be involved in intracellular trafficking via microtubule-related transport. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product